PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g36740.1.p
Common NameBRADI_3g36740, LOC100838603
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 377aa    MW: 40272.6 Da    PI: 8.716
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g36740.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.7e-1678123147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg W + Ed +l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  Bradi3g36740.1.p  78 RGHWRPAEDAKLRELVALYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 123
                       899*****************************.***********996 PP

2Myb_DNA-binding491.4e-15131173246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +++ eE+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Bradi3g36740.1.p 131 RPFSDEEEERLMGAHRFYGNK-WAMIARLFP-GRTDNAVKNHWHV 173
                       68*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.45773124IPR017930Myb domain
SMARTSM007176.1E-1477126IPR001005SANT/Myb domain
SuperFamilySSF466891.16E-2778171IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-2679131IPR009057Homeodomain-like
CDDcd001673.90E-1381122No hitNo description
PfamPF139219.3E-1681141No hitNo description
PROSITE profilePS5129423.756125179IPR017930Myb domain
SMARTSM007172.0E-11129177IPR001005SANT/Myb domain
CDDcd001671.27E-9132172No hitNo description
Gene3DG3DSA:1.10.10.601.8E-19132178IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MPCSSVSPPW LLRVAAEQAA AAASSSSSST KGGGRVLTAT MDDTGATTGA AGGYNNNGQQ  60
ESCSSGQSSR QQQQLAARGH WRPAEDAKLR ELVALYGPQN WNLIAEKLDG RSGKSCRLRW  120
FNQLDPRISK RPFSDEEEER LMGAHRFYGN KWAMIARLFP GRTDNAVKNH WHVIMARKYR  180
EQSTAYRRRK LNQAVQRKLD SSSSSSVLPL STAAAGPGAG HVDFQQQQFD YSAGADGFSF  240
RHYCFPPFHG GSGAAAIAAA SVQEPSFCLF PGPSAALVHD GRLMTGWGGG DQGMGLARYG  300
DAPPPFLLPA SHGGWIAGGG SHHELARFIS DEAINGPPAG AARDHQQQQQ QQGAHFDFDQ  360
AAASPTFIDF LGVGAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-33781787107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0419831e-123BT041983.1 Zea mays full-length cDNA clone ZM_BFb0095C08 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755863.10.0PREDICTED: myb-related protein 3R-1
TrEMBLI1I7C40.0I1I7C4_BRADI; Uncharacterized protein
STRINGBRADI3G36740.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-70myb domain protein 105